PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01343.1.p
Common NameEUGRSUZ_J01343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 372aa    MW: 41842.5 Da    PI: 9.1533
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01343.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-1770117148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd +lv +++++G+g+W++I+ + g+ R+ k+c++rw +yl
  Eucgr.J01343.1.p  70 KGPWTPEEDIILVTYIQEHGPGNWRSIPTKTGLVRCSKSCRLRWTNYL 117
                       79******************************99************97 PP

2Myb_DNA-binding48.61.9e-15123168148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Eucgr.J01343.1.p 123 RGNFTDQEEKMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 168
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-2461120IPR009057Homeodomain-like
PROSITE profilePS5129424.79965121IPR017930Myb domain
SuperFamilySSF466893.51E-3067164IPR009057Homeodomain-like
SMARTSM007176.2E-1569119IPR001005SANT/Myb domain
PfamPF002491.1E-1570117IPR001005SANT/Myb domain
CDDcd001673.23E-1272117No hitNo description
Gene3DG3DSA:1.10.10.609.9E-25121173IPR009057Homeodomain-like
SMARTSM007175.3E-16122170IPR001005SANT/Myb domain
PROSITE profilePS5129420.053122172IPR017930Myb domain
PfamPF002491.9E-14123168IPR001005SANT/Myb domain
CDDcd001674.17E-11125167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MLLFAVISFD SRPYLLGKNY TNRKEKNEKK KRRRSLVEAN GKILFAEKCR GLSGFGMGRP  60
PCCDQNGVKK GPWTPEEDII LVTYIQEHGP GNWRSIPTKT GLVRCSKSCR LRWTNYLRPG  120
IKRGNFTDQE EKMIIHLQAL LGNRWAAIAS YLPERTDNDI KNYWNTHLKK KLKKLELSPY  180
EDPIPMSRGQ WEKRLQTDIH LARQALCDAL SPEKPSASSD LSEAKHKPFP GSSLSSKPVQ  240
TLTTIYPSST ENIAKLLKGW TKDPAKQAHR TVVADLSMTD STSSGGGMPS NRTEVSDNVF  300
ESLIKLESLD SSTSGFSRSM SPEISHLQDE SRLRFGADDQ EQLSLLLNWL FDEAGKEQLC  360
DFPMADNADS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-26701724105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12833KKKRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01343.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032491.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU71e-102MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A059ACS00.0A0A059ACS0_EUCGR; Uncharacterized protein
STRINGGLYMA18G49360.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.14e-96myb domain protein 30